Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (27 families) |
Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
Protein automated matches [190220] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries) |
Domain d6ea4b4: 6ea4 B:638-960 [378196] Other proteins in same PDB: d6ea4a1, d6ea4a2, d6ea4a3, d6ea4a5, d6ea4b1, d6ea4b2, d6ea4b3, d6ea4b5 automated match to d3se6a4 complexed with bma, j2g, lys, man, mes, nag, zn |
PDB Entry: 6ea4 (more details), 2.45 Å
SCOPe Domain Sequences for d6ea4b4:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ea4b4 a.118.1.0 (B:638-960) automated matches {Human (Homo sapiens) [TaxId: 9606]} hgwdqlitqlnqnhtllrpkdrvglihdvfqlvgagrltldkaldmtyylqhetsspall eglsylesfyhmmdrrnisdisenlkryllqyfkpvidrqswsdkgsvwdrmlrsallkl acdlnhapciqkaaelfsqwmessgklniptdvlkivysvgaqttagwnylleqyelsms saeqnkilyalstskhqekllklielgmegkviktqnlaallhaiarrpkgqqlawdfvr enwthllkkfdlgsydirmiisgttahfsskdklqevklffesleaqgshldifqtvlet itknikwleknlptlrtwlmvnt
Timeline for d6ea4b4: