Lineage for d6ea4b4 (6ea4 B:638-960)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2338495Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2339141Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2339142Protein automated matches [190220] (14 species)
    not a true protein
  7. 2339168Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries)
  8. 2339213Domain d6ea4b4: 6ea4 B:638-960 [378196]
    Other proteins in same PDB: d6ea4a1, d6ea4a2, d6ea4a3, d6ea4a5, d6ea4b1, d6ea4b2, d6ea4b3, d6ea4b5
    automated match to d3se6a4
    complexed with bma, j2g, lys, man, mes, nag, zn

Details for d6ea4b4

PDB Entry: 6ea4 (more details), 2.45 Å

PDB Description: erap2 bound to aryl sulfonamide uncompetitive inhibitor
PDB Compounds: (B:) Endoplasmic reticulum aminopeptidase 2

SCOPe Domain Sequences for d6ea4b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ea4b4 a.118.1.0 (B:638-960) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hgwdqlitqlnqnhtllrpkdrvglihdvfqlvgagrltldkaldmtyylqhetsspall
eglsylesfyhmmdrrnisdisenlkryllqyfkpvidrqswsdkgsvwdrmlrsallkl
acdlnhapciqkaaelfsqwmessgklniptdvlkivysvgaqttagwnylleqyelsms
saeqnkilyalstskhqekllklielgmegkviktqnlaallhaiarrpkgqqlawdfvr
enwthllkkfdlgsydirmiisgttahfsskdklqevklffesleaqgshldifqtvlet
itknikwleknlptlrtwlmvnt

SCOPe Domain Coordinates for d6ea4b4:

Click to download the PDB-style file with coordinates for d6ea4b4.
(The format of our PDB-style files is described here.)

Timeline for d6ea4b4: