Lineage for d6ca9c2 (6ca9 C:107-212)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. Protein automated matches [190374] (15 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1239 PDB entries)
  8. Domain d6ca9c2: 6ca9 C:107-212 [378180]
    Other proteins in same PDB: d6ca9a1, d6ca9b_, d6ca9c1, d6ca9d_
    automated match to d1dn0a2
    complexed with gol, peg

Details for d6ca9c2

PDB Entry: 6ca9 (more details), 2.7 Å

PDB Description: crystal structure of fab pct64_lmca (sar), the least mutated common ancestor of the hiv-1 broadly neutralizing antibody lineage pct64
PDB Compounds: (C:) PCT64_LMCA Fab light chain

SCOPe Domain Sequences for d6ca9c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ca9c2 b.1.1.2 (C:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d6ca9c2 are not available.

Timeline for d6ca9c2:

Domains from same chain:
(mouse over for more information)
d6ca9c1
Domains from other chains:
(mouse over for more information)
d6ca9a1, d6ca9a2, d6ca9b_, d6ca9d_