Lineage for d6ca9c1 (6ca9 C:1-106)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355178Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)
  8. 2355641Domain d6ca9c1: 6ca9 C:1-106 [378177]
    Other proteins in same PDB: d6ca9a2, d6ca9c2
    automated match to d1dn0a1
    complexed with gol, peg

Details for d6ca9c1

PDB Entry: 6ca9 (more details), 2.7 Å

PDB Description: crystal structure of fab pct64_lmca (sar), the least mutated common ancestor of the hiv-1 broadly neutralizing antibody lineage pct64
PDB Compounds: (C:) PCT64_LMCA Fab light chain

SCOPe Domain Sequences for d6ca9c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ca9c1 b.1.1.1 (C:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
drfsgsgsgtdftltisrlepedfavyycqqsarsftfgpgtkvdi

SCOPe Domain Coordinates for d6ca9c1:

Click to download the PDB-style file with coordinates for d6ca9c1.
(The format of our PDB-style files is described here.)

Timeline for d6ca9c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ca9c2