Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain |
Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) |
Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins) |
Protein automated matches [257342] (3 species) not a true protein |
Species Escherichia coli [TaxId:562] [350276] (4 PDB entries) |
Domain d6v2la1: 6v2l A:9-227 [378153] Other proteins in same PDB: d6v2la2 automated match to d1os1a2 complexed with act, atp, mn |
PDB Entry: 6v2l (more details), 1.7 Å
SCOPe Domain Sequences for d6v2la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6v2la1 c.109.1.1 (A:9-227) automated matches {Escherichia coli [TaxId: 562]} pqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgrspk dkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafcgan pdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqglnse nfvafnltermqliggtwyggemkkgmfsmmnyllplkg
Timeline for d6v2la1: