Lineage for d6v2la1 (6v2l A:9-227)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2920699Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2920700Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2920701Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)
  6. 2920794Protein automated matches [257342] (3 species)
    not a true protein
  7. 2920795Species Escherichia coli [TaxId:562] [350276] (4 PDB entries)
  8. 2920797Domain d6v2la1: 6v2l A:9-227 [378153]
    Other proteins in same PDB: d6v2la2
    automated match to d1os1a2
    complexed with act, atp, mn

Details for d6v2la1

PDB Entry: 6v2l (more details), 1.7 Å

PDB Description: e. coli phosphoenolpyruvate carboxykinase s250a
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase (ATP)

SCOPe Domain Sequences for d6v2la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6v2la1 c.109.1.1 (A:9-227) automated matches {Escherichia coli [TaxId: 562]}
pqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgrspk
dkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafcgan
pdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqglnse
nfvafnltermqliggtwyggemkkgmfsmmnyllplkg

SCOPe Domain Coordinates for d6v2la1:

Click to download the PDB-style file with coordinates for d6v2la1.
(The format of our PDB-style files is described here.)

Timeline for d6v2la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6v2la2