| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) ![]() less regular structure consisting of variable repeats |
| Family c.10.2.0: automated matches [191489] (1 protein) not a true family |
| Protein automated matches [190787] (14 species) not a true protein |
| Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [231246] (18 PDB entries) |
| Domain d5ufcb_: 5ufc B: [378142] automated match to d3e6ja_ complexed with dr2 |
PDB Entry: 5ufc (more details), 1.89 Å
SCOPe Domain Sequences for d5ufcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ufcb_ c.10.2.0 (B:) automated matches {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
cpsqcscrgtyvdcdsrrlasvpagiptnvqilnlynnqitnlepgvfdrlvnlqklyls
gnqlqalpvgvfdklsqltflsldenkltalpngvfdklteltylnlntnqltalpegvf
drlvhlkellmccnkltelprgierlthlthlaldqnqlksiphgafdrlsslthaylfg
npwdcecrdimylrnwvadhtsivmrwdgkavndpdsakcagtntpvravteastspskc
Timeline for d5ufcb_: