Lineage for d1fnwb2 (1fnw B:408-521)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325381Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 325763Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 325764Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)
  6. 325819Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)
  7. 325820Species Streptococcus pyogenes [TaxId:1314] [54357] (7 PDB entries)
  8. 325842Domain d1fnwb2: 1fnw B:408-521 [37814]
    Other proteins in same PDB: d1fnwa1, d1fnwb1, d1fnwc1, d1fnwd1, d1fnwe1, d1fnwf1, d1fnwg1, d1fnwh1

Details for d1fnwb2

PDB Entry: 1fnw (more details), 3.9 Å

PDB Description: crystal structure of streptococcal pyrogenic exotoxin a

SCOP Domain Sequences for d1fnwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnwb2 d.15.6.1 (B:408-521) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldnktsqievylttk

SCOP Domain Coordinates for d1fnwb2:

Click to download the PDB-style file with coordinates for d1fnwb2.
(The format of our PDB-style files is described here.)

Timeline for d1fnwb2: