SCOPe 2.08: Domain d5ueia1: 5uei A:21-262

Lineage for d5ueia1 (5uei A:21-262)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (14 species)
   not a true protein

7. Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [231246] (18 PDB entries)

8. Domain d5ueia1: 5uei A:21-262 [378133]
   Other proteins in same PDB: d5ueia2
   automated match to d3e6ja_
   complexed with cl, gol

Details for d5ueia1

PDB Entry: 5uei, 1.7 Å

PDB Description: crystal structure of variable lymphocyte receptor (vlr) o13 (apo)

PDB Compounds: (A:) o13

SCOPe Domain Sequences for d5ueia1:

Sequence; same for both SEQRES and ATOM records:

>d5ueia1 c.10.2.0 (A:21-262) automated matches {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
acpsqcscsgttvnckskslasvpagiptttrvlylndnqitklepgvfdrlvnlqtlwl
nnnqltslpaglfdsltqltilaldsnqlqalpvgvfgrlvdlqqlylgsnqlsalpsav
fdrlvhlkellmccnkltelprgierlthlthlaldqnqlksiphgafdrlsslthaylf
gnpwdcecrdimylrnwvadhtsivmrwdgkavndpdsakcagtntpvravteastspsk
cp

Timeline for d5ueia1:

• d5ueia1 first appeared in SCOPe 2.07