Lineage for d1fnvd2 (1fnv D:1008-1121)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30383Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 30633Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 30634Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)
  6. 30674Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)
  7. 30675Species Streptococcus pyogenes [TaxId:1314] [54357] (4 PDB entries)
  8. 30687Domain d1fnvd2: 1fnv D:1008-1121 [37812]
    Other proteins in same PDB: d1fnva1, d1fnvb1, d1fnvc1, d1fnvd1

Details for d1fnvd2

PDB Entry: 1fnv (more details), 3.6 Å

PDB Description: structure of streptococcal pyrogenic exotoxin a

SCOP Domain Sequences for d1fnvd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnvd2 d.15.6.1 (D:1008-1121) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldnktsqievylttk

SCOP Domain Coordinates for d1fnvd2:

Click to download the PDB-style file with coordinates for d1fnvd2.
(The format of our PDB-style files is described here.)

Timeline for d1fnvd2: