SCOPe 2.08: Domain d6r2wl3: 6r2w L:87-143

Lineage for d6r2wl3 (6r2w L:87-143)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries)
   Uniprot P08709 108-202 ! Uniprot P08709 107-202

8. Domain d6r2wl3: 6r2w L:87-143 [378110]
   Other proteins in same PDB: d6r2wh_, d6r2wl1, d6r2wt1, d6r2wt2
   automated match to d2a2ql2
   complexed with 0z7, ca, fuc, tma

Details for d6r2wl3

PDB Entry: 6r2w, 1.25 Å

PDB Description: crystal structure of the super-active fviia variant vyt in complex with tissue factor

PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d6r2wl3:

Sequence; same for both SEQRES and ATOM records:

>d6r2wl3 g.3.11.1 (L:87-143) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilek

Timeline for d6r2wl3:

• d6r2wl3 first appeared in SCOPe 2.07