Lineage for d6qafb1 (6qaf B:3-319)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481831Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2481832Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2481833Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. 2481854Protein Arginase [52770] (5 species)
  7. 2481886Species Human (Homo sapiens) [TaxId:9606] [142346] (33 PDB entries)
    Uniprot P05089 5-313
  8. 2481926Domain d6qafb1: 6qaf B:3-319 [378106]
    Other proteins in same PDB: d6qafa2, d6qafb2
    automated match to d3gmza_
    complexed with mn, na, xc3

Details for d6qafb1

PDB Entry: 6qaf (more details), 1.61 Å

PDB Description: crystal structure of human arginase-1 at ph 9.0 in complex with cb- 1158/incb001158
PDB Compounds: (B:) Arginase-1

SCOPe Domain Sequences for d6qafb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qafb1 c.42.1.1 (B:3-319) Arginase {Human (Homo sapiens) [TaxId: 9606]}
aksrtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipnds
pfqivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviw
vdahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdv
dpgehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftp
atgtpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitla
cfglaregnhkpidyln

SCOPe Domain Coordinates for d6qafb1:

Click to download the PDB-style file with coordinates for d6qafb1.
(The format of our PDB-style files is described here.)

Timeline for d6qafb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6qafb2