Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (70 species) not a true protein |
Species Escherichia coli [TaxId:562] [225496] (22 PDB entries) |
Domain d6pq9a_: 6pq9 A: [378097] automated match to d5gs8a_ complexed with act, asp, gol, so4 |
PDB Entry: 6pq9 (more details), 2.19 Å
SCOPe Domain Sequences for d6pq9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pq9a_ e.3.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]} kgtdslkssiekylkdkkakvgvavlgiednfklnvnekhhypmqgtykfhlalavldkl dkenisidkklfvkksellpntwsplrdkypdgnvdlsiseilkatvsrsdnngcdilfr fvggtnkvhnfisklgvknisikateeemhkawnvqytnwttpdatvqllkkfykneils knsydyllntmietttgpkrlkgllpdgtvvahktgssdtndkgitaatndigiitlpng khfaiavyvsdsseksdvnekiiaeicksvwdylvk
Timeline for d6pq9a_: