Lineage for d6pq9a_ (6pq9 A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3014403Species Escherichia coli [TaxId:562] [225496] (22 PDB entries)
  8. 3014435Domain d6pq9a_: 6pq9 A: [378097]
    automated match to d5gs8a_
    complexed with act, asp, gol, so4

Details for d6pq9a_

PDB Entry: 6pq9 (more details), 2.19 Å

PDB Description: crystal structure of tla-1 s70g extended spectrum beta-lactamase
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6pq9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pq9a_ e.3.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
kgtdslkssiekylkdkkakvgvavlgiednfklnvnekhhypmqgtykfhlalavldkl
dkenisidkklfvkksellpntwsplrdkypdgnvdlsiseilkatvsrsdnngcdilfr
fvggtnkvhnfisklgvknisikateeemhkawnvqytnwttpdatvqllkkfykneils
knsydyllntmietttgpkrlkgllpdgtvvahktgssdtndkgitaatndigiitlpng
khfaiavyvsdsseksdvnekiiaeicksvwdylvk

SCOPe Domain Coordinates for d6pq9a_:

Click to download the PDB-style file with coordinates for d6pq9a_.
(The format of our PDB-style files is described here.)

Timeline for d6pq9a_: