Lineage for d6pg6b_ (6pg6 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808917Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2809156Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2809157Protein automated matches [190568] (11 species)
    not a true protein
  7. 2809207Species Human (Homo sapiens) [TaxId:9606] [187559] (94 PDB entries)
  8. 2809282Domain d6pg6b_: 6pg6 B: [378093]
    automated match to d4gm9b_
    complexed with cl, oh7, so4

Details for d6pg6b_

PDB Entry: 6pg6 (more details), 1.68 Å

PDB Description: wdr5delta23 bound to n-(4-(5-(hydroxymethyl)-1h-imidazol-2-yl)butyl) acetamide
PDB Compounds: (B:) WD repeat-containing protein 5

SCOPe Domain Sequences for d6pg6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pg6b_ b.69.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghklgi
sdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsfd
esvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktli
dddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsvtg
gkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktiklw
ksdc

SCOPe Domain Coordinates for d6pg6b_:

Click to download the PDB-style file with coordinates for d6pg6b_.
(The format of our PDB-style files is described here.)

Timeline for d6pg6b_: