Lineage for d6pg4a1 (6pg4 A:32-334)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2418201Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2418399Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2418634Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2418635Protein automated matches [190568] (9 species)
    not a true protein
  7. 2418681Species Human (Homo sapiens) [TaxId:9606] [187559] (91 PDB entries)
  8. 2418742Domain d6pg4a1: 6pg4 A:32-334 [378082]
    Other proteins in same PDB: d6pg4a2
    automated match to d4gm9b_
    complexed with ohg, so4

Details for d6pg4a1

PDB Entry: 6pg4 (more details), 1.6 Å

PDB Description: wdr5delta32 bound to (2-methyl-1h-imidazol-4-yl)methanol
PDB Compounds: (A:) WD repeat-containing protein 5

SCOPe Domain Sequences for d6pg4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pg4a1 b.69.4.0 (A:32-334) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghklgis
dvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsfde
svriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktlid
ddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsvtgg
kwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktiklwk
sdc

SCOPe Domain Coordinates for d6pg4a1:

Click to download the PDB-style file with coordinates for d6pg4a1.
(The format of our PDB-style files is described here.)

Timeline for d6pg4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6pg4a2