![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
![]() | Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species) |
![]() | Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries) Uniprot P08095 |
![]() | Domain d1b1zd2: 1b1z D:108-220 [37808] Other proteins in same PDB: d1b1za1, d1b1zb1, d1b1zc1, d1b1zd1 |
PDB Entry: 1b1z (more details), 2.57 Å
SCOPe Domain Sequences for d1b1zd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b1zd2 d.15.6.1 (D:108-220) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]} gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpsky etgyikfipknkesfwfdffpepeftqskylmiykdnetldsntsqievyltt
Timeline for d1b1zd2: