SCOPe 2.08: Domain d6pgea1: 6pge A:32-334

Lineage for d6pgea1 (6pge A:32-334)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.4: WD40 repeat-like [50978] (4 families)
   also contains 8-bladed propellers

5. Family b.69.4.0: automated matches [191412] (1 protein)
   not a true family

6. Protein automated matches [190568] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187559] (94 PDB entries)

8. Domain d6pgea1: 6pge A:32-334 [378062]
   Other proteins in same PDB: d6pgea2
   automated match to d4gm9b_
   complexed with edo, ojm, so4

Details for d6pgea1

PDB Entry: 6pge, 1.76 Å

PDB Description: wdr5delta32 bound to ethyl 3-(4-(hydroxymethyl)-1h-imidazol-2-yl) propanoate

PDB Compounds: (A:) WD repeat-containing protein 5

SCOPe Domain Sequences for d6pgea1:

Sequence; same for both SEQRES and ATOM records:

>d6pgea1 b.69.4.0 (A:32-334) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghklgis
dvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsfde
svriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktlid
ddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsvtgg
kwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktiklwk
sdc

Timeline for d6pgea1:

• d6pgea1 first appeared in SCOPe 2.07