SCOPe 2.03: Domain d1b1zb2: 1b1z B:108-220

Lineage for d1b1zb2 (1b1z B:108-220)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries)
   Uniprot P08095

8. Domain d1b1zb2: 1b1z B:108-220 [37806]
   Other proteins in same PDB: d1b1za1, d1b1zb1, d1b1zc1, d1b1zd1

Details for d1b1zb2

PDB Entry: 1b1z, 2.57 Å

PDB Description: streptococcal pyrogenic exotoxin a1

PDB Compounds: (B:) protein (toxin)

SCOPe Domain Sequences for d1b1zb2:

Sequence; same for both SEQRES and ATOM records:

>d1b1zb2 d.15.6.1 (B:108-220) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldsntsqievyltt

Timeline for d1b1zb2:

• d1b1zb2 first appeared (with stable ids) in SCOP 1.55
  
• d1b1zb2 appears in SCOPe 2.02
  
• d1b1zb2 appears in SCOPe 2.04
  
• d1b1zb2 appears in the current release, SCOPe 2.08