Lineage for d1fnud2 (1fnu D:1008-1121)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2541472Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2541473Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2541578Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)
  7. 2541579Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries)
    Uniprot P08095
  8. 2541583Domain d1fnud2: 1fnu D:1008-1121 [37804]
    Other proteins in same PDB: d1fnua1, d1fnub1, d1fnuc1, d1fnud1
    complexed with cd

Details for d1fnud2

PDB Entry: 1fnu (more details), 1.94 Å

PDB Description: structure of streptococcal pyrogenic exotoxin a
PDB Compounds: (D:) exotoxin type a precursor (allele 1)

SCOPe Domain Sequences for d1fnud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnud2 d.15.6.1 (D:1008-1121) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldnktsqievylttk

SCOPe Domain Coordinates for d1fnud2:

Click to download the PDB-style file with coordinates for d1fnud2.
(The format of our PDB-style files is described here.)

Timeline for d1fnud2: