Lineage for d6naca1 (6nac A:1-126)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2540890Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2541095Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2541144Protein Fe-only hydrogenase, N-terminal domain [54313] (1 species)
  7. 2541145Species Clostridium pasteurianum [TaxId:1501] [54314] (7 PDB entries)
  8. 2541149Domain d6naca1: 6nac A:1-126 [378032]
    Other proteins in same PDB: d6naca2, d6naca3
    automated match to d1feha2
    complexed with 402, fes, gol, sf4

Details for d6naca1

PDB Entry: 6nac (more details), 1.55 Å

PDB Description: crystal structure of [fefe]-hydrogenase i (cpi) solved with single pulse free electron laser data
PDB Compounds: (A:) Iron hydrogenase 1

SCOPe Domain Sequences for d6naca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6naca1 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]}
mktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvt
acdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykara
skpflp

SCOPe Domain Coordinates for d6naca1:

Click to download the PDB-style file with coordinates for d6naca1.
(The format of our PDB-style files is described here.)

Timeline for d6naca1: