SCOP 1.63: Domain d1fnuc2: 1fnu C:708-821

Lineage for d1fnuc2 (1fnu C:708-821)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)

6. Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [54357] (7 PDB entries)

8. Domain d1fnuc2: 1fnu C:708-821 [37803]
   Other proteins in same PDB: d1fnua1, d1fnub1, d1fnuc1, d1fnud1

Details for d1fnuc2

PDB Entry: 1fnu, 1.94 Å

PDB Description: structure of streptococcal pyrogenic exotoxin a

SCOP Domain Sequences for d1fnuc2:

Sequence; same for both SEQRES and ATOM records:

>d1fnuc2 d.15.6.1 (C:708-821) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldnktsqievylttk

Timeline for d1fnuc2:

• d1fnuc2 first appeared (with stable ids) in SCOP 1.55
  
• d1fnuc2 appears in SCOP 1.61
  
• d1fnuc2 appears in SCOP 1.65
  
• d1fnuc2 appears in the current release, SCOPe 2.08