Lineage for d6naja3 (6naj A:599-737)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2361736Superfamily b.1.15: Integrin domains [69179] (2 families) (S)
  5. 2361765Family b.1.15.0: automated matches [233856] (1 protein)
    not a true family
  6. 2361766Protein automated matches [233857] (1 species)
    not a true protein
  7. 2361767Species Human (Homo sapiens) [TaxId:9606] [233858] (15 PDB entries)
  8. 3077967Domain d6naja3: 6naj A:599-737 [378029]
    Other proteins in same PDB: d6naja1, d6najc_
    automated match to d1m1xa2
    complexed with bma, man, mn, nag

Details for d6naja3

PDB Entry: 6naj (more details), 3.1 Å

PDB Description: integrin alphavbeta3 ectodomain bound to hr10 variant of the 10th domain of fibronectin.
PDB Compounds: (A:) Integrin alpha-V

SCOPe Domain Sequences for d6naja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6naja3 b.1.15.0 (A:599-737) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dnvckpklevsvdsdqkkiyigddnpltlivkaqnqgegayeaelivsiplqadfigvvr
nnealarlscafktenqtrqvvcdlgnpmkagtqllaglrfsvhqqsemdtsvkfdlqiq
ssnlfdkvspvvshkvdla

SCOPe Domain Coordinates for d6naja3:

Click to download the PDB-style file with coordinates for d6naja3.
(The format of our PDB-style files is described here.)

Timeline for d6naja3:

  • d6naja3 is new in SCOPe 2.07-stable