Lineage for d6naja1 (6naj A:1-438)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2399102Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2399674Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) (S)
  5. 2399675Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 proteins)
  6. 2399717Protein automated matches [254690] (1 species)
    not a true protein
  7. 2399718Species Human (Homo sapiens) [TaxId:9606] [255892] (14 PDB entries)
  8. 3077965Domain d6naja1: 6naj A:1-438 [378027]
    Other proteins in same PDB: d6naja2, d6naja3, d6naja4, d6najc_
    automated match to d1m1xa4
    complexed with bma, man, mn, nag

Details for d6naja1

PDB Entry: 6naj (more details), 3.1 Å

PDB Description: integrin alphavbeta3 ectodomain bound to hr10 variant of the 10th domain of fibronectin.
PDB Compounds: (A:) Integrin alpha-V

SCOPe Domain Sequences for d6naja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6naja1 b.69.8.1 (A:1-438) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fnldvdspaeysgpegsyfgfavdffvpsassrmfllvgapkanttqpgiveggqvlkcd
wsstrrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkq
erepvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywq
gqlisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfv
sgvpraartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplf
mdrgsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiai
aapyggedkkgivyifngrstglnavpsqilegqwaarsmppsfgysmkgatdidkngyp
dlivgafgvdrailyrar

SCOPe Domain Coordinates for d6naja1:

Click to download the PDB-style file with coordinates for d6naja1.
(The format of our PDB-style files is described here.)

Timeline for d6naja1:

  • d6naja1 is new in SCOPe 2.07-stable