Lineage for d1fnub2 (1fnu B:408-521)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253998Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 254362Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 254363Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)
  6. 254415Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)
  7. 254416Species Streptococcus pyogenes [TaxId:1314] [54357] (7 PDB entries)
  8. 254418Domain d1fnub2: 1fnu B:408-521 [37802]
    Other proteins in same PDB: d1fnua1, d1fnub1, d1fnuc1, d1fnud1

Details for d1fnub2

PDB Entry: 1fnu (more details), 1.94 Å

PDB Description: structure of streptococcal pyrogenic exotoxin a

SCOP Domain Sequences for d1fnub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnub2 d.15.6.1 (B:408-521) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldnktsqievylttk

SCOP Domain Coordinates for d1fnub2:

Click to download the PDB-style file with coordinates for d1fnub2.
(The format of our PDB-style files is described here.)

Timeline for d1fnub2: