Lineage for d1bxtb2 (1bxt B:120-234)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130887Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 131197Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 131198Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)
  6. 131282Protein Streptococcal superantigen SSA [54354] (1 species)
  7. 131283Species Streptococcus pyogenes [TaxId:1314] [54355] (1 PDB entry)
  8. 131285Domain d1bxtb2: 1bxt B:120-234 [37800]
    Other proteins in same PDB: d1bxta1, d1bxtb1

Details for d1bxtb2

PDB Entry: 1bxt (more details), 1.85 Å

PDB Description: streptococcal superantigen (ssa) from streptococcus pyogenes

SCOP Domain Sequences for d1bxtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxtb2 d.15.6.1 (B:120-234) Streptococcal superantigen SSA {Streptococcus pyogenes}
qiegkfpnitvkvyednenilsfdittnkkqvtvqeldcktrkilvsrknlyefnnspye
tgyikfiessgdsfwydmmpapgaifdqskylmlyndnktvsssaiaievhltkk

SCOP Domain Coordinates for d1bxtb2:

Click to download the PDB-style file with coordinates for d1bxtb2.
(The format of our PDB-style files is described here.)

Timeline for d1bxtb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bxtb1