SCOP 1.55: Domain d1bxtb2: 1bxt B:120-234

Lineage for d1bxtb2 (1bxt B:120-234)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)

6. Protein Streptococcal superantigen SSA [54354] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [54355] (1 PDB entry)

8. Domain d1bxtb2: 1bxt B:120-234 [37800]
   Other proteins in same PDB: d1bxta1, d1bxtb1

Details for d1bxtb2

PDB Entry: 1bxt, 1.85 Å

PDB Description: streptococcal superantigen (ssa) from streptococcus pyogenes

SCOP Domain Sequences for d1bxtb2:

Sequence; same for both SEQRES and ATOM records:

>d1bxtb2 d.15.6.1 (B:120-234) Streptococcal superantigen SSA {Streptococcus pyogenes}
qiegkfpnitvkvyednenilsfdittnkkqvtvqeldcktrkilvsrknlyefnnspye
tgyikfiessgdsfwydmmpapgaifdqskylmlyndnktvsssaiaievhltkk

Timeline for d1bxtb2:

• d1bxtb2 appears in SCOP 1.57
  
• d1bxtb2 appears in the current release, SCOPe 2.08