SCOPe 2.08: Domain d6iwnb_: 6iwn B:

Lineage for d6iwnb_ (6iwn B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
   4 helices; folded leaf; right-handed superhelix

4. Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families)
   can be classified as disulfide-rich

5. Family a.52.1.0: automated matches [254196] (1 protein)
   not a true family

6. Protein automated matches [254428] (8 species)
   not a true protein

7. Species Solanum melongena [TaxId:4111] [336505] (5 PDB entries)

8. Domain d6iwnb_: 6iwn B: [377987]
   automated match to d5tviw_
   complexed with gol, myr, trs

Details for d6iwnb_

PDB Entry: 6iwn, 2.41 Å

PDB Description: structural insight into probable lipid transfer mechanism of non- specific lipid transfer protein via intermediate structures in solanum melongena

PDB Compounds: (B:) Non-specific lipid-transfer protein

SCOPe Domain Sequences for d6iwnb_:

Sequence; same for both SEQRES and ATOM records:

>d6iwnb_ a.52.1.0 (B:) automated matches {Solanum melongena [TaxId: 4111]}
vtcgqvdanlapcvpfltqggepgaaccsgvktlngnaqspddrktacncikaaanrypn
lkddaaqslpskcgislnvpisrtincdtis

Timeline for d6iwnb_:

• d6iwnb_ first appeared in SCOPe 2.07