SCOPe 2.08: Domain d6iwsa1: 6iws A:3-73

Lineage for d6iwsa1 (6iws A:3-73)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.3: Chaperone J-domain [46565] (2 families)

5. Family a.2.3.0: automated matches [191473] (1 protein)
   not a true family

6. Protein automated matches [190750] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255094] (10 PDB entries)

8. Domain d6iwsa1: 6iws A:3-73 [377982]
   Other proteins in same PDB: d6iwsa2
   automated match to d1bqza_

Details for d6iwsa1

PDB Entry: 6iws

PDB Description: solution structure of the j-domain of tid1, a mitochondrial hsp40/dnaj protein

PDB Compounds: (A:) DnaJ homolog subfamily A member 3, mitochondrial

SCOPe Domain Sequences for d6iwsa1:

Sequence; same for both SEQRES and ATOM records:

>d6iwsa1 a.2.3.0 (A:3-73) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lakedyyqilgvprnasqkeikkayyqlakkyhpdtnkddpkakekfsqlaeayevlsde
vkrkqydaygs

Timeline for d6iwsa1:

• d6iwsa1 first appeared in SCOPe 2.07