SCOPe 2.06: Domain d1et6b2: 1et6 B:97-209

Lineage for d1et6b2 (1et6 B:97-209)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Streptococcal superantigen Smez-2 [54352] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [54353] (2 PDB entries)

8. Domain d1et6b2: 1et6 B:97-209 [37798]
   Other proteins in same PDB: d1et6a1, d1et6b1

Details for d1et6b2

PDB Entry: 1et6, 1.9 Å

PDB Description: crystal structure of the superantigen smez-2 from streptococcus pyogenes

PDB Compounds: (B:) superantigen smez-2

SCOPe Domain Sequences for d1et6b2:

Sequence, based on SEQRES records:

>d1et6b2 d.15.6.1 (B:97-209) Streptococcal superantigen Smez-2 {Streptococcus pyogenes [TaxId: 1314]}
tsipknipvnlwingkqisvpyneistnkttvtaqeidlkvrkfliaqhqlyssgssyks
grlvfhtndnsdkysfdlfyvgyrdkesifkvykdnksfnidkighldieids

Sequence, based on observed residues (ATOM records):

>d1et6b2 d.15.6.1 (B:97-209) Streptococcal superantigen Smez-2 {Streptococcus pyogenes [TaxId: 1314]}
tsipknipvnlwingkqisvpyneistnkttvtaqeidlkvrkfliaqhqlyssgssyks
grlvfhtkysfdlfyvgyrdkesifkvykdnksfnidkighldieids

Timeline for d1et6b2:

• d1et6b2 first appeared (with stable ids) in SCOP 1.55
  
• d1et6b2 appears in SCOPe 2.05
  
• d1et6b2 appears in SCOPe 2.07
  
• d1et6b2 appears in the current release, SCOPe 2.08