Lineage for d1et6b2 (1et6 B:97-209)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2160286Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2160287Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 protein domains)
  6. 2160434Protein Streptococcal superantigen Smez-2 [54352] (1 species)
  7. 2160435Species Streptococcus pyogenes [TaxId:1314] [54353] (2 PDB entries)
  8. 2160439Domain d1et6b2: 1et6 B:97-209 [37798]
    Other proteins in same PDB: d1et6a1, d1et6b1

Details for d1et6b2

PDB Entry: 1et6 (more details), 1.9 Å

PDB Description: crystal structure of the superantigen smez-2 from streptococcus pyogenes
PDB Compounds: (B:) superantigen smez-2

SCOPe Domain Sequences for d1et6b2:

Sequence, based on SEQRES records: (download)

>d1et6b2 d.15.6.1 (B:97-209) Streptococcal superantigen Smez-2 {Streptococcus pyogenes [TaxId: 1314]}
tsipknipvnlwingkqisvpyneistnkttvtaqeidlkvrkfliaqhqlyssgssyks
grlvfhtndnsdkysfdlfyvgyrdkesifkvykdnksfnidkighldieids

Sequence, based on observed residues (ATOM records): (download)

>d1et6b2 d.15.6.1 (B:97-209) Streptococcal superantigen Smez-2 {Streptococcus pyogenes [TaxId: 1314]}
tsipknipvnlwingkqisvpyneistnkttvtaqeidlkvrkfliaqhqlyssgssyks
grlvfhtkysfdlfyvgyrdkesifkvykdnksfnidkighldieids

SCOPe Domain Coordinates for d1et6b2:

Click to download the PDB-style file with coordinates for d1et6b2.
(The format of our PDB-style files is described here.)

Timeline for d1et6b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1et6b1