SCOPe 2.07: Domain d6hhdd1: 6hhd D:6-125

Lineage for d6hhdd1 (6hhd D:6-125)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)

8. Domain d6hhdd1: 6hhd D:6-125 [377963]
   Other proteins in same PDB: d6hhda_, d6hhdb2, d6hhdc_, d6hhdd2
   automated match to d4gftb_
   complexed with cl, gol, na, so4

Details for d6hhdd1

PDB Entry: 6hhd, 2.1 Å

PDB Description: mouse prion protein in complex with nanobody 484

PDB Compounds: (D:) Nanobody 484

SCOPe Domain Sequences for d6hhdd1:

Sequence; same for both SEQRES and ATOM records:

>d6hhdd1 b.1.1.1 (D:6-125) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
esggglvqpggslrlscaasgrtfssynmgwfrqapgkgrefvasitssgdksdytdsvk
grftisrdnakntmylqmnnlkpedtatyycarglgiyiirarggydhwgqgtqvtvssh

Timeline for d6hhdd1:

• d6hhdd1 is new in SCOPe 2.07-stable
  
• d6hhdd1 appears in the current release, SCOPe 2.08