Lineage for d6hhdc_ (6hhd C:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. Protein automated matches [191016] (9 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [234629] (15 PDB entries)
  8. Domain d6hhdc_: 6hhd C: [377961]
    Other proteins in same PDB: d6hhdb1, d6hhdb2, d6hhdd1, d6hhdd2
    automated match to d1i4ma_
    complexed with cl, gol, na, so4

Details for d6hhdc_

PDB Entry: 6hhd (more details), 2.1 Å

PDB Description: mouse prion protein in complex with nanobody 484
PDB Compounds: (C:) major prion protein

SCOPe Domain Sequences for d6hhdc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hhdc_ d.6.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gavvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvhd
cvnitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqay

SCOPe Domain Coordinates for d6hhdc_ are not available.

Timeline for d6hhdc_:

Domains from other chains:
(mouse over for more information)
d6hhda_, d6hhdb1, d6hhdb2, d6hhdd1, d6hhdd2