Lineage for d6hhdb1 (6hhd B:6-124)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein automated matches [190119] (23 species)
    not a true protein
  7. Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)
  8. Domain d6hhdb1: 6hhd B:6-124 [377960]
    Other proteins in same PDB: d6hhda_, d6hhdb2, d6hhdc_, d6hhdd2
    automated match to d5da4a_
    complexed with cl, gol, na, so4

Details for d6hhdb1

PDB Entry: 6hhd (more details), 2.1 Å

PDB Description: mouse prion protein in complex with nanobody 484
PDB Compounds: (B:) Nanobody 484

SCOPe Domain Sequences for d6hhdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hhdb1 b.1.1.1 (B:6-124) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
esggglvqpggslrlscaasgrtfssynmgwfrqapgkgrefvasitssgdksdytdsvk
grftisrdnakntmylqmnnlkpedtatyycarglgiyiirarggydhwgqgtqvtvss

SCOPe Domain Coordinates for d6hhdb1 are not available.

Timeline for d6hhdb1:

Domains from same chain:
(mouse over for more information)
d6hhdb2
Domains from other chains:
(mouse over for more information)
d6hhda_, d6hhdc_, d6hhdd1, d6hhdd2