Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries) |
Domain d6hhdb1: 6hhd B:6-124 [377960] Other proteins in same PDB: d6hhda_, d6hhdb2, d6hhdc_, d6hhdd2 automated match to d5da4a_ complexed with cl, gol, na, so4 |
PDB Entry: 6hhd (more details), 2.1 Å
SCOPe Domain Sequences for d6hhdb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hhdb1 b.1.1.1 (B:6-124) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]} esggglvqpggslrlscaasgrtfssynmgwfrqapgkgrefvasitssgdksdytdsvk grftisrdnakntmylqmnnlkpedtatyycarglgiyiirarggydhwgqgtqvtvss
Timeline for d6hhdb1:
View in 3D Domains from other chains: (mouse over for more information) d6hhda_, d6hhdc_, d6hhdd1, d6hhdd2 |