SCOP 1.55: Domain d1eu3b2: 1eu3 B:97-209

Lineage for d1eu3b2 (1eu3 B:97-209)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)

6. Protein Streptococcal superantigen Smez-2 [54352] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [54353] (2 PDB entries)

8. Domain d1eu3b2: 1eu3 B:97-209 [37796]
   Other proteins in same PDB: d1eu3a1, d1eu3b1

Details for d1eu3b2

PDB Entry: 1eu3, 1.68 Å

PDB Description: crystal structure of the superantigen smez-2 (zinc bound) from streptococcus pyogenes

SCOP Domain Sequences for d1eu3b2:

Sequence; same for both SEQRES and ATOM records:

>d1eu3b2 d.15.6.1 (B:97-209) Streptococcal superantigen Smez-2 {Streptococcus pyogenes}
tsipknipvnlwingkqisvpyneistnkttvtaqeidlkvrkfliaqhqlyssgssyks
grlvfhtndnsdkysfdlfyvgyrdkesifkvykdnksfnidkighldieids

Timeline for d1eu3b2:

• d1eu3b2 appears in SCOP 1.57
  
• d1eu3b2 appears in the current release, SCOPe 2.08