Lineage for d6pfyq_ (6pfy Q:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631476Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families) (S)
    automatically mapped to Pfam PF02507
  5. 2631477Family f.23.16.1: Subunit III of photosystem I reaction centre, PsaF [81535] (2 proteins)
  6. 2631481Protein automated matches [236583] (4 species)
    not a true protein
  7. 2631491Species Thermosynechococcus elongatus [TaxId:197221] [377791] (4 PDB entries)
  8. 2631499Domain d6pfyq_: 6pfy Q: [377959]
    Other proteins in same PDB: d6pfya_, d6pfyb_, d6pfyc_, d6pfye_, d6pfyg_, d6pfyh_, d6pfyi_, d6pfyj_, d6pfyl_, d6pfym_, d6pfyn_, d6pfyo_, d6pfyp_, d6pfyr_, d6pfys_, d6pfyu_, d6pfyv_, d6pfyw_, d6pfyx_, d6pfyy_, d6pfyz_
    automated match to d1jb0f_
    complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6pfyq_

PDB Entry: 6pfy (more details), 2.9 Å

PDB Description: membrane protein megahertz crystallography at the european xfel, photosystem i at synchrotron to 2.9 a
PDB Compounds: (Q:) Photosystem I reaction center subunit III

SCOPe Domain Sequences for d6pfyq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pfyq_ f.23.16.1 (Q:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
dvaglvpckdspafqkraaaavnttadpasgqkrferysqalcgedglphlvvdgrlsra
gdflipsvlflyiagwigwvgrayliavrnsgeanekeiiidvplaikcmltgfawplaa
lkelasgeltakdneitvspr

SCOPe Domain Coordinates for d6pfyq_:

Click to download the PDB-style file with coordinates for d6pfyq_.
(The format of our PDB-style files is described here.)

Timeline for d6pfyq_: