Lineage for d6pfyg_ (6pfy G:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633135Fold f.29: Photosystem I subunits PsaA/PsaB [81559] (1 superfamily)
    core:11 transmembrane helices
  4. 2633136Superfamily f.29.1: Photosystem I subunits PsaA/PsaB [81558] (2 families) (S)
    automatically mapped to Pfam PF00223
  5. 2633137Family f.29.1.1: Photosystem I subunits PsaA/PsaB [81557] (3 proteins)
    Photosystem I p700 chlorophyll a apoprotein a1/a2
  6. 2633148Protein automated matches [236561] (7 species)
    not a true protein
  7. 2633191Species Thermosynechococcus elongatus [TaxId:197221] [377774] (4 PDB entries)
  8. 2633201Domain d6pfyg_: 6pfy G: [377955]
    Other proteins in same PDB: d6pfyc_, d6pfyd_, d6pfye_, d6pfyf_, d6pfyh_, d6pfyi_, d6pfyj_, d6pfyl_, d6pfym_, d6pfyn_, d6pfyo_, d6pfyp_, d6pfyq_, d6pfyr_, d6pfys_, d6pfyu_, d6pfyv_, d6pfyw_, d6pfyx_
    automated match to d5oy0a_
    complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6pfyg_

PDB Entry: 6pfy (more details), 2.9 Å

PDB Description: membrane protein megahertz crystallography at the european xfel, photosystem i at synchrotron to 2.9 a
PDB Compounds: (G:) photosystem I p700 chlorophyll a apoprotein a1

SCOPe Domain Sequences for d6pfyg_:

Sequence, based on SEQRES records: (download)

>d6pfyg_ f.29.1.1 (G:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
vrvvvdndpvptsfekwakpghfdrtlargpqtttwiwnlhalahdfdthtsdledisrk
ifsahfghlavvfiwlsgmyfhgakfsnyeawladptgikpsaqvvwpivgqgilngdvg
ggfhgiqitsglfqlwrasgitnefqlyctaigglvmaglmlfagwfhyhkrapklewfq
nvesmlnhhlagllglgslawaghqihvslpinklldagvaakdiplphefilnpslmae
lypkvdwgffsgvipfftfnwaaysdfltfngglnpvtgglwlsdtahhhlaiavlfiia
ghmyrtnwgighslkeileahkgpftgaghkglyevlttswhaqlainlammgslsiiva
qhmyamppypylatdyptqlslfthhmwiggflvvggaahgaifmvrdydpamnqnnvld
rvlrhrdaiishlnwvciflgfhsfglyvhndtmrafgrpqdmfsdtgiqlqpvfaqwvq
nlhtlapggtapnaaatasvafggdvvavggkvammpivlgtadfmvhhihaftihvtvl
illkgvlfarssrlipdkanlgfrfpcdgpgrggtcqvsgwdhvflglfwmyncisvvif
hfswkmqsdvwgtvapdgtvshitggnfaqsaitingwlrdflwaqasqvigsygsalsa
ygllflgahfiwafslmflfsgrgywqeliesivwahnklkvapaiqpralsiiqgravg
vahyllggiattwafflariisvg

Sequence, based on observed residues (ATOM records): (download)

>d6pfyg_ f.29.1.1 (G:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
vrvvvdndpvptsfekwakpghfdrtlargpqtttwiwnlhalahdfdthtsdledisrk
ifsahfghlavvfiwlsgmyfhgakfsnyeawladptgikpsaqvvwpivgqgilngdvg
ggfhgiqitsglfqlwrasgitnefqlyctaigglvmaglmlfagwfhyhkrapklewfq
nvesmlnhhlagllglgslawaghqihvslpinklldagvaakdiplphefilnpslmae
lypkvdwgffspfftfnwaaysdfltfngglnpvtgglwlsdtahhhlaiavlfiiaghm
yrtnwgighslkeileahkgpftgaghkglyevlttswhaqlainlammgslsiivaqhm
yamppypylatdyptqlslfthhmwiggflvvggaahgaifmvrdydpamnqnnvldrvl
rhrdaiishlnwvciflgfhsfglyvhndtmrafgrpqdmfsdtgiqlqpvfaqwvqnlh
tlapggtapnaaatasvafggdvvavggkvammpivlgtadfmvhhihaftihvtvlill
kgvlfarssrlipdkanlgfrfpcdgpgrggtcqvsgwdhvflglfwmyncisvvifhfs
wkmqsdvwgtvapdgtvshitggnfaqsaitingwlrdflwaqasqvigsygsalsaygl
lflgahfiwafslmflfsgrgywqeliesivwahnklkvapaiqpralsiiqgravgvah
yllggiattwafflariisvg

SCOPe Domain Coordinates for d6pfyg_:

Click to download the PDB-style file with coordinates for d6pfyg_.
(The format of our PDB-style files is described here.)

Timeline for d6pfyg_: