SCOPe 2.08: Domain d6pfyp_: 6pfy P:

Lineage for d6pfyp_ (6pfy P:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families)

5. Family b.34.4.2: Photosystem I accessory protein E (PsaE) [50094] (2 proteins)
   automatically mapped to Pfam PF02427

6. Protein automated matches [347347] (4 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [377953] (5 PDB entries)

8. Domain d6pfyp_: 6pfy P: [377954]
   Other proteins in same PDB: d6pfya_, d6pfyb_, d6pfyc_, d6pfyd_, d6pfye_, d6pfyf_, d6pfyg_, d6pfyh_, d6pfyi_, d6pfyj_, d6pfyl_, d6pfym_, d6pfyn_, d6pfyo_, d6pfyq_, d6pfyr_, d6pfys_, d6pfyu_, d6pfyv_, d6pfyw_, d6pfyx_, d6pfyy_, d6pfyz_
   automated match to d1qp2a_
   complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6pfyp_

PDB Entry: 6pfy, 2.9 Å

PDB Description: membrane protein megahertz crystallography at the european xfel, photosystem i at synchrotron to 2.9 a

PDB Compounds: (P:) photosystem I reaction center subunit IV

SCOPe Domain Sequences for d6pfyp_:

Sequence; same for both SEQRES and ATOM records:

>d6pfyp_ b.34.4.2 (P:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
vqrgskvkilrpesywynevgtvasvdqtpgvkypvivrfdkvnytgysgsasgvntnnf
alhevqeva

Timeline for d6pfyp_:

• d6pfyp_ first appeared in SCOPe 2.07