SCOPe 2.07: Domain d6pfyv_: 6pfy V:

Lineage for d6pfyv_ (6pfy V:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.19: Subunit XII of photosystem I reaction centre, PsaM [81548] (1 family)
   automatically mapped to Pfam PF07465

5. Family f.23.19.1: Subunit XII of photosystem I reaction centre, PsaM [81547] (2 proteins)

6. Protein Subunit XII of photosystem I reaction centre, PsaM [81546] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:197221] [377772] (4 PDB entries)

8. Domain d6pfyv_: 6pfy V: [377952]
   Other proteins in same PDB: d6pfya_, d6pfyb_, d6pfyc_, d6pfyd_, d6pfye_, d6pfyf_, d6pfyg_, d6pfyh_, d6pfyi_, d6pfyj_, d6pfyl_, d6pfyn_, d6pfyo_, d6pfyp_, d6pfyq_, d6pfyr_, d6pfys_, d6pfyu_, d6pfyw_, d6pfyx_, d6pfyy_, d6pfyz_
   automated match to d1jb0m_
   complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6pfyv_

PDB Entry: 6pfy, 2.9 Å

PDB Description: membrane protein megahertz crystallography at the european xfel, photosystem i at synchrotron to 2.9 a

PDB Compounds: (V:) Photosystem I reaction center subunit XII

SCOPe Domain Sequences for d6pfyv_:

Sequence; same for both SEQRES and ATOM records:

>d6pfyv_ f.23.19.1 (V:) Subunit XII of photosystem I reaction centre, PsaM {Thermosynechococcus elongatus [TaxId: 197221]}
altdtqvyvalviallpavlafrlstelyk

Timeline for d6pfyv_:

• d6pfyv_ is new in SCOPe 2.07-stable
  
• d6pfyv_ appears in the current release, SCOPe 2.08