![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
![]() | Protein Streptococcal superantigen Smez-2 [54352] (1 species) |
![]() | Species Streptococcus pyogenes [TaxId:1314] [54353] (2 PDB entries) |
![]() | Domain d1eu3a2: 1eu3 A:97-209 [37795] Other proteins in same PDB: d1eu3a1, d1eu3b1, d1eu3b3 complexed with k, po4, zn |
PDB Entry: 1eu3 (more details), 1.68 Å
SCOPe Domain Sequences for d1eu3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eu3a2 d.15.6.1 (A:97-209) Streptococcal superantigen Smez-2 {Streptococcus pyogenes [TaxId: 1314]} tsipknipvnlwingkqisvpyneistnkttvtaqeidlkvrkfliaqhqlyssgssyks grlvfhtndnsdkysfdlfyvgyrdkesifkvykdnksfnidkighldieids
Timeline for d1eu3a2: