SCOPe 2.08: Domain d6pfyj_: 6pfy J:

Lineage for d6pfyj_ (6pfy J:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families)
   automatically mapped to Pfam PF01701

5. Family f.23.18.1: Subunit IX of photosystem I reaction centre, PsaJ [81543] (2 proteins)

6. Protein Subunit IX of photosystem I reaction centre, PsaJ [81542] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:197221] [377947] (5 PDB entries)

8. Domain d6pfyj_: 6pfy J: [377948]
   Other proteins in same PDB: d6pfya_, d6pfyb_, d6pfyc_, d6pfyd_, d6pfye_, d6pfyf_, d6pfyg_, d6pfyh_, d6pfyi_, d6pfyl_, d6pfym_, d6pfyn_, d6pfyo_, d6pfyp_, d6pfyq_, d6pfyr_, d6pfyu_, d6pfyv_, d6pfyw_, d6pfyx_, d6pfyy_, d6pfyz_
   automated match to d1jb0j_
   complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6pfyj_

PDB Entry: 6pfy, 2.9 Å

PDB Description: membrane protein megahertz crystallography at the european xfel, photosystem i at synchrotron to 2.9 a

PDB Compounds: (J:) Photosystem I reaction center subunit IX

SCOPe Domain Sequences for d6pfyj_:

Sequence; same for both SEQRES and ATOM records:

>d6pfyj_ f.23.18.1 (J:) Subunit IX of photosystem I reaction centre, PsaJ {Thermosynechococcus elongatus [TaxId: 197221]}
mkhfltylstapvlaaiwmtitagiliefnrfypdllfhpl

Timeline for d6pfyj_:

• d6pfyj_ first appeared in SCOPe 2.07