![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
![]() | Protein Streptococcal superantigen Spe-H [54350] (1 species) |
![]() | Species Streptococcus pyogenes [TaxId:1314] [54351] (2 PDB entries) |
![]() | Domain d1eu4a2: 1eu4 A:96-204 [37794] Other proteins in same PDB: d1eu4a1 complexed with zn |
PDB Entry: 1eu4 (more details), 2.5 Å
SCOPe Domain Sequences for d1eu4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eu4a2 d.15.6.1 (A:96-204) Streptococcal superantigen Spe-H {Streptococcus pyogenes [TaxId: 1314]} ekkeikvpvnvwdkskqqppmfitvnkpkvtaqevdikvrkllikkydiynnreqkyskg tvtldlnsgkdivfdlyyfgngdfnsmlkiysnneridstqfhvdvsis
Timeline for d1eu4a2: