Lineage for d1eu4a2 (1eu4 A:96-204)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77788Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 78065Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 78066Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)
  6. 78144Protein Streptococcal superantigen Spe-H [54350] (1 species)
  7. 78145Species Streptococcus pyogenes [TaxId:1314] [54351] (2 PDB entries)
  8. 78147Domain d1eu4a2: 1eu4 A:96-204 [37794]
    Other proteins in same PDB: d1eu4a1

Details for d1eu4a2

PDB Entry: 1eu4 (more details), 2.5 Å

PDB Description: crystal structure of the superantigen spe-h (zinc bound) from streptococcus pyogenes

SCOP Domain Sequences for d1eu4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eu4a2 d.15.6.1 (A:96-204) Streptococcal superantigen Spe-H {Streptococcus pyogenes}
ekkeikvpvnvwdkskqqppmfitvnkpkvtaqevdikvrkllikkydiynnreqkyskg
tvtldlnsgkdivfdlyyfgngdfnsmlkiysnneridstqfhvdvsis

SCOP Domain Coordinates for d1eu4a2:

Click to download the PDB-style file with coordinates for d1eu4a2.
(The format of our PDB-style files is described here.)

Timeline for d1eu4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eu4a1