Lineage for d6uy1d1 (6uy1 D:20-129)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2706929Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [371895] (3 PDB entries)
  8. 2706933Domain d6uy1d1: 6uy1 D:20-129 [377929]
    Other proteins in same PDB: d6uy1a2, d6uy1b2, d6uy1d2, d6uy1e2, d6uy1g2
    automated match to d1e6ia_
    complexed with mg

Details for d6uy1d1

PDB Entry: 6uy1 (more details), 2.21 Å

PDB Description: crystal structure of the sth1 bromodomain from saccharomyces cerevisiae at 2.2 angstrom resolution
PDB Compounds: (D:) Nuclear protein STH1/NPS1

SCOPe Domain Sequences for d6uy1d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uy1d1 a.29.2.0 (D:20-129) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gifptveklveemreqldevdshprtsifeklpskrdypdyfkviekpmaidiilknckn
gtyktleevrqalqtmfenarfyneegswvyvdadklneftdewfkehss

SCOPe Domain Coordinates for d6uy1d1:

Click to download the PDB-style file with coordinates for d6uy1d1.
(The format of our PDB-style files is described here.)

Timeline for d6uy1d1: