Lineage for d6uy1f_ (6uy1 F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2319938Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2320170Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2320171Protein automated matches [190615] (14 species)
    not a true protein
  7. 2321501Species Saccharomyces cerevisiae [TaxId:559292] [371895] (3 PDB entries)
  8. 2321507Domain d6uy1f_: 6uy1 F: [377927]
    Other proteins in same PDB: d6uy1a2, d6uy1b2, d6uy1d2, d6uy1e2, d6uy1g2
    automated match to d1e6ia_
    complexed with mg

Details for d6uy1f_

PDB Entry: 6uy1 (more details), 2.21 Å

PDB Description: crystal structure of the sth1 bromodomain from saccharomyces cerevisiae at 2.2 angstrom resolution
PDB Compounds: (F:) Nuclear protein STH1/NPS1

SCOPe Domain Sequences for d6uy1f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uy1f_ a.29.2.0 (F:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
gifptveklveemreqldevdshprtsifeklpskrdypdyfkviekpmaidiilknckn
gtyktleevrqalqtmfenarfyneegswvyvdadklneftdewfkehs

SCOPe Domain Coordinates for d6uy1f_:

Click to download the PDB-style file with coordinates for d6uy1f_.
(The format of our PDB-style files is described here.)

Timeline for d6uy1f_: