Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins) |
Protein Streptococcal superantigen Spe-C [54348] (1 species) |
Species Streptococcus pyogenes [TaxId:1314] [54349] (3 PDB entries) |
Domain d1hqrd2: 1hqr D:596-708 [37792] Other proteins in same PDB: d1hqra1, d1hqra2, d1hqrb1, d1hqrb2, d1hqrd1 complexed with zn |
PDB Entry: 1hqr (more details), 3.2 Å
SCOP Domain Sequences for d1hqrd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hqrd2 d.15.6.1 (D:596-708) Streptococcal superantigen Spe-C {Streptococcus pyogenes [TaxId: 1314]} nkvnhkllgnlfisgesqqnlnnkiilekdivtfqeidfkirkylmdnykiydatspyvs grieigtkdgkheqidlfdspnegtrsdifakykdnriinmknfshfdiylek
Timeline for d1hqrd2:
View in 3D Domains from other chains: (mouse over for more information) d1hqra1, d1hqra2, d1hqrb1, d1hqrb2 |