Class a: All alpha proteins [46456] (290 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
Protein automated matches [190615] (15 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [371895] (3 PDB entries) |
Domain d6uy1b1: 6uy1 B:20-129 [377915] Other proteins in same PDB: d6uy1a2, d6uy1b2, d6uy1d2, d6uy1e2, d6uy1g2 automated match to d1e6ia_ complexed with mg |
PDB Entry: 6uy1 (more details), 2.21 Å
SCOPe Domain Sequences for d6uy1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6uy1b1 a.29.2.0 (B:20-129) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gifptveklveemreqldevdshprtsifeklpskrdypdyfkviekpmaidiilknckn gtyktleevrqalqtmfenarfyneegswvyvdadklneftdewfkehss
Timeline for d6uy1b1: