Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins) |
Protein Streptococcal superantigen Spe-C [54348] (1 species) |
Species Streptococcus pyogenes [TaxId:1314] [54349] (3 PDB entries) |
Domain d1an8a2: 1an8 A:96-208 [37791] Other proteins in same PDB: d1an8a1 |
PDB Entry: 1an8 (more details), 2.4 Å
SCOP Domain Sequences for d1an8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1an8a2 d.15.6.1 (A:96-208) Streptococcal superantigen Spe-C {Streptococcus pyogenes [TaxId: 1314]} nkvnhkllgnlfisgesqqnlnnkiilekdivtfqeidfkirkylmdnykiydatspyvs grieigtkdgkheqidlfdspnegtrsdifakykdnriinmknfshfdiylek
Timeline for d1an8a2: