SCOPe 2.08: Domain d6uy1g1: 6uy1 G:20-129

Lineage for d6uy1g1 (6uy1 G:20-129)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [371895] (3 PDB entries)

8. Domain d6uy1g1: 6uy1 G:20-129 [377909]
   Other proteins in same PDB: d6uy1a2, d6uy1b2, d6uy1d2, d6uy1e2, d6uy1g2
   automated match to d1e6ia_
   complexed with mg

Details for d6uy1g1

PDB Entry: 6uy1, 2.21 Å

PDB Description: crystal structure of the sth1 bromodomain from saccharomyces cerevisiae at 2.2 angstrom resolution

PDB Compounds: (G:) Nuclear protein STH1/NPS1

SCOPe Domain Sequences for d6uy1g1:

Sequence; same for both SEQRES and ATOM records:

>d6uy1g1 a.29.2.0 (G:20-129) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gifptveklveemreqldevdshprtsifeklpskrdypdyfkviekpmaidiilknckn
gtyktleevrqalqtmfenarfyneegswvyvdadklneftdewfkehss

Timeline for d6uy1g1:

• d6uy1g1 first appeared in SCOPe 2.07