Lineage for d6u6ic_ (6u6i C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520303Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2520304Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2520305Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
  6. 2520406Protein Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) [267661] (1 species)
  7. 2520407Species Norway rat (Rattus norvegicus) [TaxId:10116] [267740] (8 PDB entries)
  8. 2520424Domain d6u6ic_: 6u6i C: [377905]
    automated match to d3h5va_
    complexed with bma, nag

Details for d6u6ic_

PDB Entry: 6u6i (more details), 3.12 Å

PDB Description: ntd of glua2 in complex with cnih3 - with antagonist zk200775 - in asymmetric global conformation
PDB Compounds: (C:) Glutamate receptor 2

SCOPe Domain Sequences for d6u6ic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u6ic_ c.93.1.1 (C:) Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivd
yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
kigywsevdkmvvt

SCOPe Domain Coordinates for d6u6ic_:

Click to download the PDB-style file with coordinates for d6u6ic_.
(The format of our PDB-style files is described here.)

Timeline for d6u6ic_: