Lineage for d1f77b2 (1f77 B:102-213)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30383Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 30633Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 30634Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)
  6. 30668Protein Staphylococcal enterotoxin H, SEH [54346] (1 species)
  7. 30669Species Staphylococcus aureus [TaxId:1280] [54347] (3 PDB entries)
  8. 30673Domain d1f77b2: 1f77 B:102-213 [37790]
    Other proteins in same PDB: d1f77a1, d1f77b1

Details for d1f77b2

PDB Entry: 1f77 (more details), 2.4 Å

PDB Description: staphylococcal enterotoxin h determined to 2.4 a resolution

SCOP Domain Sequences for d1f77b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f77b2 d.15.6.1 (B:102-213) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus}
eklaqerviganvwvdgiqketelirtnkknvtlqeldikirkilsdkykiyykdseisk
gliefdmktprdysfdiydlkgendyeidkiyednktlksddishidvnlyt

SCOP Domain Coordinates for d1f77b2:

Click to download the PDB-style file with coordinates for d1f77b2.
(The format of our PDB-style files is described here.)

Timeline for d1f77b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f77b1