Lineage for d1f77a2 (1f77 A:102-214)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2541472Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2541473Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2541570Protein Staphylococcal enterotoxin H, SEH [54346] (1 species)
  7. 2541571Species Staphylococcus aureus [TaxId:1280] [54347] (5 PDB entries)
  8. 2541575Domain d1f77a2: 1f77 A:102-214 [37789]
    Other proteins in same PDB: d1f77a1, d1f77b1
    complexed with so4

Details for d1f77a2

PDB Entry: 1f77 (more details), 2.4 Å

PDB Description: staphylococcal enterotoxin h determined to 2.4 a resolution
PDB Compounds: (A:) enterotoxin h

SCOPe Domain Sequences for d1f77a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f77a2 d.15.6.1 (A:102-214) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus [TaxId: 1280]}
eklaqerviganvwvdgiqketelirtnkknvtlqeldikirkilsdkykiyykdseisk
gliefdmktprdysfdiydlkgendyeidkiyednktlksddishidvnlytk

SCOPe Domain Coordinates for d1f77a2:

Click to download the PDB-style file with coordinates for d1f77a2.
(The format of our PDB-style files is described here.)

Timeline for d1f77a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f77a1