SCOPe 2.02: Domain d1f77a2: 1f77 A:102-214

Lineage for d1f77a2 (1f77 A:102-214)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins)

6. Protein Staphylococcal enterotoxin H, SEH [54346] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54347] (4 PDB entries)

8. Domain d1f77a2: 1f77 A:102-214 [37789]
   Other proteins in same PDB: d1f77a1, d1f77b1
   complexed with so4

Details for d1f77a2

PDB Entry: 1f77, 2.4 Å

PDB Description: staphylococcal enterotoxin h determined to 2.4 a resolution

PDB Compounds: (A:) enterotoxin h

SCOPe Domain Sequences for d1f77a2:

Sequence; same for both SEQRES and ATOM records:

>d1f77a2 d.15.6.1 (A:102-214) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus [TaxId: 1280]}
eklaqerviganvwvdgiqketelirtnkknvtlqeldikirkilsdkykiyykdseisk
gliefdmktprdysfdiydlkgendyeidkiyednktlksddishidvnlytk

Timeline for d1f77a2:

• d1f77a2 first appeared (with stable ids) in SCOP 1.55
  
• d1f77a2 appears in SCOPe 2.01
  
• d1f77a2 appears in SCOPe 2.03
  
• d1f77a2 appears in the current release, SCOPe 2.08